Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nostoc sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Nostoc sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q8YQI2

Expression Region

1-82

Origin

Nostoc sp. (strain PCC 7120 / UTEX 2576)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTTGERPFSDIVTSIRYWVIHSITIPALFIAGWLFVSTGLAYDVFGTPRPDEYYTQAR QELPIVNNRFEAKKQVEQLIQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sumf1 Mouse Gene Knockout Kit (CRISPR)
KN516978 1 Kit

Sumf1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GDF7 Antibody
8C15987-AAT 50 µg

GDF7 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Esophagus
CS804380 5x 5 µm

Tissue FFPE Sections, Esophagus

Sign In for Pricing
View Details
Phenetrazine Hydrochloride
TRC-P296330-10MG 10 mg

Phenetrazine Hydrochloride

Sign In for Pricing
View Details
H-Arg (Pmc) -2-CT Polystyrene Resin
H0370753303.5G 5 g

H-Arg (Pmc) -2-CT Polystyrene Resin

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS634327 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details