Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Oenothera elata subsp. hookeri Cytochrome b559 subunit alpha (psbE)

This Recombinant Oenothera elata subsp. hookeri Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 2-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q9MTK5

Expression Region

2-83

Origin

Oenothera elata subsp. hookeri (Hooker's evening primrose) (Oenothera hookeri)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQ GIPLITGRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL
BNC470040-100 1x 100 µL

CD35 / CR1 (E11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL
BNC940253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF740 conjugate, 0.1mg/mL
BNC742208-100 1x 100 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/2208R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF640R conjugate, 0.1mg/mL
BNC402427-500 1x 500 µL

P63 (Squamous, Basal & Myoepithelial Cell Marker) (TP63/2427), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1961), CF488A conjugate, 0.1mg/mL
BNC881961-100 1x 100 µL

Tryptase (Mast Cell Marker) (TPSAB1/1961), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details