Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nephroselmis olivacea ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Nephroselmis olivacea ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q9TL14

Expression Region

1-82

Origin

Nephroselmis olivacea (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPLIAAASVVAAGLAVGLASIGPGIGQGTAAGQAVGGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse IgG1 (Fcγ Fragment specific), AlpHcAbs® Goat antibody (Biotin)
HA710122 100 µg

Mouse IgG1 (Fcγ Fragment specific), AlpHcAbs® Goat antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Mouse B7-DC/PD-L2/CD273 Protein (Fc Tag)
PKSM040481-01 100 µg

Recombinant Mouse B7-DC/PD-L2/CD273 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse B7-DC/PD-L2/CD273 Protein (Fc Tag)
PKSM040481-02 1 mg

Recombinant Mouse B7-DC/PD-L2/CD273 Protein (Fc Tag)

Sign In for Pricing
View Details
COMMD6 (NM_203495) Human Over-expression Lysate
LC404247 20 µg

COMMD6 (NM_203495) Human Over-expression Lysate

Sign In for Pricing
View Details
RAB21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G3]
TA505719AM 100 µL

RAB21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6G3]

Sign In for Pricing
View Details
Human CXCL6/GCP-2 Recombinant Rabbit monoclonal Antibody
HA723315 100 µL

Human CXCL6/GCP-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details