Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nephroselmis olivacea ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Nephroselmis olivacea ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q9TL14

Expression Region

1-82

Origin

Nephroselmis olivacea (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPLIAAASVVAAGLAVGLASIGPGIGQGTAAGQAVGGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBP50 (SLC9A3R1) (NM_004252) Human Over-expression Lysate
LC401364 20 µg

EBP50 (SLC9A3R1) (NM_004252) Human Over-expression Lysate

Sign In for Pricing
View Details
Alpha-Ergocryptine
TRC-E597500-1MG 1 mg

Alpha-Ergocryptine

Sign In for Pricing
View Details
Tiafenacil Metabolite M-56
TRC-T436340-1MG 1 mg

Tiafenacil Metabolite M-56

Sign In for Pricing
View Details
Kir5.1 Rabbit Polyclonal Antibody
ER1901-24 100 µL

Kir5.1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF640R conjugate, 0.1mg/mL
BNC401958-500 1x 500 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS627172 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details