Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nephroselmis olivacea ATP synthase subunit c, chloroplastic (atpH)

This Recombinant Nephroselmis olivacea ATP synthase subunit c, chloroplastic (atpH) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

ATP synthase subunit c, chloroplastic, ATP synthase F (0) sector subunit c, ATPase subunit III, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q9TL14

Expression Region

1-82

Origin

Nephroselmis olivacea (Green alga)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPLIAAASVVAAGLAVGLASIGPGIGQGTAAGQAVGGIARQPEAEGKIRGTLLLSLAFM EALTIYGLVVALALLFANPFVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HRAS like suppressor (HRASLS) activation kit by CRISPRa
GA111378 1 Kit

Human HRAS like suppressor (HRASLS) activation kit by CRISPRa

Sign In for Pricing
View Details
PKD2 (Ab-876) Antibody
8B0808-AAT 50 µg

PKD2 (Ab-876) Antibody

Sign In for Pricing
View Details
Mouse Itgam activation kit by CRISPRa
GA202200 1 Kit

Mouse Itgam activation kit by CRISPRa

Sign In for Pricing
View Details
PYHIN1 Human qPCR Primer Pair (NM_152501)
HP217757 200 Reactions

PYHIN1 Human qPCR Primer Pair (NM_152501)

Sign In for Pricing
View Details
ARF3 Rabbit Polyclonal Antibody
AP17123PU-N 400 µL

ARF3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XAGE1A (NM_001097592) Human Over-expression Lysate
LC420386 20 µg

XAGE1A (NM_001097592) Human Over-expression Lysate

Sign In for Pricing
View Details