Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Immediate early response 3-interacting protein 1 (Ier3ip1)

This Recombinant Mouse Immediate early response 3-interacting protein 1 (Ier3ip1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1

UniProt

Q9CR20

Expression Region

1-82

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVR TVMRVPLIIVNSITIVLLLLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Crispld1 (NM_001134963) Rat Tagged ORF Clone Lentiviral Particle
RR210774L3V 200 µL

Crispld1 (NM_001134963) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Active Integrin Alpha 2 (ITGa2)
TRV-0005088-01 10 µg

Active Integrin Alpha 2 (ITGa2)

Sign In for Pricing
View Details
Active Integrin Alpha 2 (ITGa2)
TRV-0005088-02 50 µg

Active Integrin Alpha 2 (ITGa2)

Sign In for Pricing
View Details
Active Integrin Alpha 2 (ITGa2)
TRV-0005088-03 100 µg

Active Integrin Alpha 2 (ITGa2)

Sign In for Pricing
View Details
Active Integrin Alpha 2 (ITGa2)
TRV-0005088-04 200 µg

Active Integrin Alpha 2 (ITGa2)

Sign In for Pricing
View Details
Active Integrin Alpha 2 (ITGa2)
TRV-0005088-05 500 µg

Active Integrin Alpha 2 (ITGa2)

Sign In for Pricing
View Details