Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Immediate early response 3-interacting protein 1 (Ier3ip1)

This Recombinant Rat Immediate early response 3-interacting protein 1 (Ier3ip1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1

UniProt

P85007

Expression Region

1-82

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIRSVR TVMRVPLIIVNSITIVLLLLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ITIH6 siRNA
abx920950-01 15 nmol

Human ITIH6 siRNA

Sign In for Pricing
View Details
Human ITIH6 siRNA
abx920950-02 30 nmol

Human ITIH6 siRNA

Sign In for Pricing
View Details
Myosin-13 (MYH13) Canine ELISA Kit
F1959 96 Tests

Myosin-13 (MYH13) Canine ELISA Kit

Sign In for Pricing
View Details
PI 3-kinase p110 (D-4) Alexa Fluor® 680
sc-8010 AF680 200 µg/mL

PI 3-kinase p110 (D-4) Alexa Fluor® 680

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Elongation factor Ts (tsf)
MBS1322932-01 0.02 mg (E-Coli)

Recombinant Ralstonia metallidurans Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Ralstonia metallidurans Elongation factor Ts (tsf)
MBS1322932-02 0.02 mg (Yeast)

Recombinant Ralstonia metallidurans Elongation factor Ts (tsf)

Sign In for Pricing
View Details