Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Immediate early response 3-interacting protein 1 (Ier3ip1)

This Recombinant Rat Immediate early response 3-interacting protein 1 (Ier3ip1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1

UniProt

P85007

Expression Region

1-82

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIRSVR TVMRVPLIIVNSITIVLLLLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Immumoglobulin A ELISA Kit
MBS761168-01 48 Well

Porcine Immumoglobulin A ELISA Kit

Sign In for Pricing
View Details
Porcine Immumoglobulin A ELISA Kit
MBS761168-02 96 Well

Porcine Immumoglobulin A ELISA Kit

Sign In for Pricing
View Details
Porcine Immumoglobulin A ELISA Kit
MBS761168-03 5x 96 Well

Porcine Immumoglobulin A ELISA Kit

Sign In for Pricing
View Details
Porcine Immumoglobulin A ELISA Kit
MBS761168-04 10x 96 Well

Porcine Immumoglobulin A ELISA Kit

Sign In for Pricing
View Details
LPHN2 Lentiviral Vector (Human) (pLenti-GIII-CMV )
27564061 1.0 µg DNA

LPHN2 Lentiviral Vector (Human) (pLenti-GIII-CMV )

Sign In for Pricing
View Details
Recombinant Trypanosoma cruzi Antigen 1F8 (1F8), N-GST-His
VG9F23-01 1 mg

Recombinant Trypanosoma cruzi Antigen 1F8 (1F8), N-GST-His

Sign In for Pricing
View Details