Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Immediate early response 3-interacting protein 1 (Ier3ip1)

This Recombinant Rat Immediate early response 3-interacting protein 1 (Ier3ip1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Immediate early response 3-interacting protein 1

UniProt

P85007

Expression Region

1-82

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFTLYSLMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIRSVR TVMRVPLIIVNSITIVLLLLFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tenascin, NT (Cytotactin, Tenascin C, Glioma associated Extracellular Matrix Antigen, GMEM, Hexabrachion) (FITC)
T2550-40-FITC 100 µL

Tenascin, NT (Cytotactin, Tenascin C, Glioma associated Extracellular Matrix Antigen, GMEM, Hexabrachion) (FITC)

Sign In for Pricing
View Details
Spice1 (NM_144550) Mouse Tagged Lenti ORF Clone
MR210983L3 10 µg

Spice1 (NM_144550) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CICP4 3'UTR Luciferase Stable Cell Line
TU004440 1.0 mL

CICP4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Satb1 (NM_001163630) Mouse Tagged Lenti ORF Clone
MR223653L3 10 µg

Satb1 (NM_001163630) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SNAIL (SNAI1) (NM_005985) Human Tagged ORF Clone Lentiviral Particle
RC204581L4V 200 µL

SNAIL (SNAI1) (NM_005985) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Dog Interleukin 6 (IL6) CLIA Kit
EKN49914 96 Tests

Dog Interleukin 6 (IL6) CLIA Kit

Sign In for Pricing
View Details