Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cortexin-1 (CTXN1)

This Recombinant Human Cortexin-1 (CTXN1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cortexin-1

UniProt

P60606

Expression Region

1-82

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRM PASSWTDHKEALERGQFDYALV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Lamin B1/LMNB1 Antibody Picoband® Fluoro647 Conjugated
PA1048-Fluoro647 100 µg/Vial

Anti-Lamin B1/LMNB1 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Human Inter Alpha-Globulin Inhibitor H5 (ITIH5) ELISA Kit
DL-ITIH5-Hu-01 48 Tests

Human Inter Alpha-Globulin Inhibitor H5 (ITIH5) ELISA Kit

Sign In for Pricing
View Details
Human Inter Alpha-Globulin Inhibitor H5 (ITIH5) ELISA Kit
DL-ITIH5-Hu-02 96 Tests

Human Inter Alpha-Globulin Inhibitor H5 (ITIH5) ELISA Kit

Sign In for Pricing
View Details
Helicobacter pylori Antibody
abx022996 1 mL

Helicobacter pylori Antibody

Sign In for Pricing
View Details
Anti-mouse apoE mAb (mE1), unconjugated
3752-3-250 250 µg

Anti-mouse apoE mAb (mE1), unconjugated

Sign In for Pricing
View Details
Gm15127 Recombinant Protein (Mouse)
RP137552 100 µg

Gm15127 Recombinant Protein (Mouse)

Sign In for Pricing
View Details