Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cortexin-1 (CTXN1)

This Recombinant Human Cortexin-1 (CTXN1) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Cortexin-1

UniProt

P60606

Expression Region

1-82

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSATWTLSPEPLPPSTGPPVGAGLDAEQRTVFAFVLCLLVVLVLLMVRCVRILLDPYSRM PASSWTDHKEALERGQFDYALV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant JEV NS1/Non-structural protein 1 Protein, C-His
VK489021-01 50 µg

Recombinant JEV NS1/Non-structural protein 1 Protein, C-His

Sign In for Pricing
View Details
Recombinant JEV NS1/Non-structural protein 1 Protein, C-His
VK489021-02 100 µg

Recombinant JEV NS1/Non-structural protein 1 Protein, C-His

Sign In for Pricing
View Details
Recombinant JEV NS1/Non-structural protein 1 Protein, C-His
VK489021-03 1 mg

Recombinant JEV NS1/Non-structural protein 1 Protein, C-His

Sign In for Pricing
View Details
Chromog. Bacillus Agar 10 x 90 mm Petri
TMB_CBCA_P90_10 10 x 90 mm Petri

Chromog. Bacillus Agar 10 x 90 mm Petri

Sign In for Pricing
View Details
Ciliary Neurotrophic Factor (CNTF) Antibody
abx102721-01 100 µL

Ciliary Neurotrophic Factor (CNTF) Antibody

Sign In for Pricing
View Details
Ciliary Neurotrophic Factor (CNTF) Antibody
abx102721-02 200 µL

Ciliary Neurotrophic Factor (CNTF) Antibody

Sign In for Pricing
View Details