Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Porcine respiratory coronavirus Envelope small membrane protein (E)

This Recombinant Porcine respiratory coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein, ORF 3, Protein 4, Protein X1

UniProt

P69611

Expression Region

1-82

Origin

Porcine respiratory coronavirus (strain 86/137004 / isolate British) (PRCoV) (PRCV)

Field of Research

Respiratory Research; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFPRALTVIDDNGMVISIIFWFLLIIILILLSIALLNIIKLCMVCCNLGRTVIIVPVQH AYDAYKNFMRIKAYNPDGALLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CXCL15/Lungkine Protein
NBP2-61349-1mg 1 mg

Recombinant Mouse CXCL15/Lungkine Protein

Sign In for Pricing
View Details
Recombinant Human TLR7 (His)
BP4552-50ug 50 µg

Recombinant Human TLR7 (His)

Sign In for Pricing
View Details
Tm6sf1 Mouse shRNA Lentiviral Particle (Locus ID 107769)
TL505799V 500 µL Each

Tm6sf1 Mouse shRNA Lentiviral Particle (Locus ID 107769)

Sign In for Pricing
View Details
UBP17, CT (USP17, Ubiquitin carboxyl-terminal hydrolase 17, Deubiquitinating enzyme 17, Ubiquitin thioesterase 17, Ubiquitin-specific-processing protease 17) (MaxLight 550)
MBS6360944-01 0.1 mL

UBP17, CT (USP17, Ubiquitin carboxyl-terminal hydrolase 17, Deubiquitinating enzyme 17, Ubiquitin thioesterase 17, Ubiquitin-specific-processing protease 17) (MaxLight 550)

Sign In for Pricing
View Details
UBP17, CT (USP17, Ubiquitin carboxyl-terminal hydrolase 17, Deubiquitinating enzyme 17, Ubiquitin thioesterase 17, Ubiquitin-specific-processing protease 17) (MaxLight 550)
MBS6360944-02 5x 0.1 mL

UBP17, CT (USP17, Ubiquitin carboxyl-terminal hydrolase 17, Deubiquitinating enzyme 17, Ubiquitin thioesterase 17, Ubiquitin-specific-processing protease 17) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Rat Amine oxidase A/MAOA protein (His tag)
MBS2571204-01 0.02 mg

Recombinant Rat Amine oxidase A/MAOA protein (His tag)

Sign In for Pricing
View Details