Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ybdJ (ybdJ)

This Recombinant Escherichia coli Uncharacterized protein ybdJ (ybdJ) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein ybdJ

UniProt

P77506

Expression Region

1-82

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL VLGAIEYFVLRFIWRRWFSLAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Skin
CS802637 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
Human IL-6 Recombinant Rabbit monoclonal Antibody
HA722233B 100 µL

Human IL-6 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
TBC1D7 Human Gene Knockout Kit (CRISPR)
KN402792 1 Kit

TBC1D7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,3-Bis(4-isobutoxybenzyl)urea
TRC-B448763-50MG 50 mg

1,3-Bis(4-isobutoxybenzyl)urea

Sign In for Pricing
View Details
Cytochrome P450 26B (CYP26B1) (418-430) Goat Polyclonal Antibody
AP23825PU-N 50 µg

Cytochrome P450 26B (CYP26B1) (418-430) Goat Polyclonal Antibody

Sign In for Pricing
View Details
Magnetic Stirrer, 7x7 inch, 115V
H3770-S 1 Each

Magnetic Stirrer, 7x7 inch, 115V

Sign In for Pricing
View Details