Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Uncharacterized protein ybdJ (ybdJ)

This Recombinant Escherichia coli Uncharacterized protein ybdJ (ybdJ) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Uncharacterized protein ybdJ

UniProt

P77506

Expression Region

1-82

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHPLETLTTAAGILLMAFLSCLLLPAPALGLALAQKLVTMFHLMDLSQLYTLLFCLWFL VLGAIEYFVLRFIWRRWFSLAD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDIA3 Recombinant Rabbit Monoclonal Antibody [PSH08-79]
HA723031 100 µL

PDIA3 Recombinant Rabbit Monoclonal Antibody [PSH08-79]

Sign In for Pricing
View Details
HSPA4L Antibody
KC-43757-01 50 μL

HSPA4L Antibody

Sign In for Pricing
View Details
HSPA4L Antibody
KC-43757-02 100 µL

HSPA4L Antibody

Sign In for Pricing
View Details
HSPA4L Antibody
KC-43757-03 1 mL

HSPA4L Antibody

Sign In for Pricing
View Details
C5orf22 Human Gene Knockout Kit (CRISPR)
KN402836 1 Kit

C5orf22 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DGKZ Antibody
KC-1025-01 50 μL

DGKZ Antibody

Sign In for Pricing
View Details