Recombinant Bacillus subtilis Uncharacterized protein yddC (yddC)
This Recombinant Bacillus subtilis Uncharacterized protein yddC (yddC) spans the amino acid sequence from region 1-82.
Product Specifications
Product Name Alternative
Uncharacterized protein yddC
UniProt
P96640
Expression Region
1-82
Origin
Bacillus subtilis (strain 168)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMKLKMGGIIFVCCIGSA VTWVIKHWSEFSGWINALMEKL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
035589-ML650 100 µL
FCN3, CT (FCN3, FCNH, HAKA1, Ficolin-3, Collagen/fibrinogen domain-containing lectin 3 p35, Collagen/fibrinogen domain-containing protein 3, Hakata antigen) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
MBS1396001-01 0.02 mg (E-Coli)
Recombinant Neisseria meningitidis serogroup A / serotype 4A 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)
Sign In for Pricing
View Details MBS1396001-02 0.02 mg (Yeast)
Recombinant Neisseria meningitidis serogroup A / serotype 4A 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)
Sign In for Pricing
View Details MBS1396001-03 0.1 mg (E-Coli)
Recombinant Neisseria meningitidis serogroup A / serotype 4A 3-octaprenyl-4-hydroxybenzoate carboxy-lyase (ubiD)
Sign In for Pricing
View Details