Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative uncharacterized protein yjhE (yjhE)

This Recombinant Escherichia coli Putative uncharacterized protein yjhE (yjhE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Putative uncharacterized protein yjhE

UniProt

P39355

Expression Region

1-82

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLADELTIGPIRAVPMDITPKYVGIASGLMNAGSAVADIISPIAFGIIIDKTGNWSLPFY GSVALLVIGIFLTFFMRPDKSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

T2R14 Polyclonal Antibody
E44H06201 100 µL

T2R14 Polyclonal Antibody

Sign In for Pricing
View Details
CARP Polyclonal Antibody
E20-70640 100 µg

CARP Polyclonal Antibody

Sign In for Pricing
View Details
Monoclonal Microphthalmia Transcription Factor (MITF) Antibody - Without BSA and Azide, Clone: SPM290
AMM01045G 0.1mg

Monoclonal Microphthalmia Transcription Factor (MITF) Antibody - Without BSA and Azide, Clone: SPM290

Sign In for Pricing
View Details
Mouse Monoclonal PIH1D2 Antibody (OTI4A10) [PE/Atto594]
NBP2-73403PEATT594 0.1 mL

Mouse Monoclonal PIH1D2 Antibody (OTI4A10) [PE/Atto594]

Sign In for Pricing
View Details
PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (PE) discontinued
040376-PE 200 µL

PQLC1, ID (PQLC1, PQ-loop repeat-containing protein 1) (PE) discontinued

Sign In for Pricing
View Details
Mouse Fibrillin 2 ELISA kit
GTR10451660 96 Well

Mouse Fibrillin 2 ELISA kit

Sign In for Pricing
View Details