Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Putative uncharacterized protein yjhE (yjhE)

This Recombinant Escherichia coli Putative uncharacterized protein yjhE (yjhE) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Putative uncharacterized protein yjhE

UniProt

P39355

Expression Region

1-82

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLADELTIGPIRAVPMDITPKYVGIASGLMNAGSAVADIISPIAFGIIIDKTGNWSLPFY GSVALLVIGIFLTFFMRPDKSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GENLISA Human Angiopoietin 2 (ANG2) ELISA
KBH7560 1x 96 Well

GENLISA Human Angiopoietin 2 (ANG2) ELISA

Sign In for Pricing
View Details
AMIGO3 Adenovirus (Human)
11839051 1.0 mL

AMIGO3 Adenovirus (Human)

Sign In for Pricing
View Details
BCL2 like 14 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-7585R-PerCP-Cy5.5 100 µL

BCL2 like 14 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-FES Antibody Picoband® Fluoro594 Conjugated
A01453-Fluoro594 100 µg/Vial

Anti-FES Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
CEACAM6 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 6, Non-specific Crossreacting Antigen, Normal Cross-reacting Antigen, CD66c, NCA) (MaxLight 550)
MBS6210748-01 0.1 mL

CEACAM6 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 6, Non-specific Crossreacting Antigen, Normal Cross-reacting Antigen, CD66c, NCA) (MaxLight 550)

Sign In for Pricing
View Details
CEACAM6 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 6, Non-specific Crossreacting Antigen, Normal Cross-reacting Antigen, CD66c, NCA) (MaxLight 550)
MBS6210748-02 5x 0.1 mL

CEACAM6 (Carcinoembryonic Antigen-related Cell Adhesion Molecule 6, Non-specific Crossreacting Antigen, Normal Cross-reacting Antigen, CD66c, NCA) (MaxLight 550)

Sign In for Pricing
View Details