Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Canine coronavirus Envelope small membrane protein (E)

This Recombinant Canine coronavirus Envelope small membrane protein (E) spans the amino acid sequence from region 1-82.

Product Specifications

Product Name Alternative

Envelope small membrane protein, E protein, sM protein

UniProt

P36696

Expression Region

1-82

Origin

Canine coronavirus (strain Insavc-1) (CCoV) (Canine enteric coronavirus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTFPRALTVIDDNGMVISIIFWFLLIIILILFSIALLNIIKLCMVCCNLGRTVIIVPARH AYDAYKNFMQIRAYNPDEALLV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

REEP4 Antibody
orb1238265-01 0.02 mg

REEP4 Antibody

Sign In for Pricing
View Details
REEP4 Antibody
orb1238265-02 0.1 mg

REEP4 Antibody

Sign In for Pricing
View Details
Human Gelsolin ELISA Kit
MBS7228324-01 48 Well

Human Gelsolin ELISA Kit

Sign In for Pricing
View Details
Human Gelsolin ELISA Kit
MBS7228324-02 96 Well

Human Gelsolin ELISA Kit

Sign In for Pricing
View Details
Human Gelsolin ELISA Kit
MBS7228324-03 5x 96 Well

Human Gelsolin ELISA Kit

Sign In for Pricing
View Details
Human Gelsolin ELISA Kit
MBS7228324-04 10x 96 Well

Human Gelsolin ELISA Kit

Sign In for Pricing
View Details