Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2101c (Mb2101c)

This Recombinant Uncharacterized protein Mb2101c (Mb2101c) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2101c

UniProt

P64932

Expression Region

1-83

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVCLIGGVAGSLWPRPAGRLRGGCYFAFMGVAWVLLAISAIANAVKGSLWWDIWSLGLL VLIPAVVYGKMRRSRRISSDQDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chk1 Rabbit mAb
MBS9466930-01 0.05 mL

Chk1 Rabbit mAb

Sign In for Pricing
View Details
Chk1 Rabbit mAb
MBS9466930-02 0.1 mL

Chk1 Rabbit mAb

Sign In for Pricing
View Details
Chk1 Rabbit mAb
MBS9466930-03 5x 0.1 mL

Chk1 Rabbit mAb

Sign In for Pricing
View Details
Sheep Prostaglandin F2 Receptor Negative Regulator (PTGFRN) ELISA Kit
MBS9923107-01 48 Well

Sheep Prostaglandin F2 Receptor Negative Regulator (PTGFRN) ELISA Kit

Sign In for Pricing
View Details
Sheep Prostaglandin F2 Receptor Negative Regulator (PTGFRN) ELISA Kit
MBS9923107-02 96 Well

Sheep Prostaglandin F2 Receptor Negative Regulator (PTGFRN) ELISA Kit

Sign In for Pricing
View Details
Sheep Prostaglandin F2 Receptor Negative Regulator (PTGFRN) ELISA Kit
MBS9923107-03 5x 96 Well

Sheep Prostaglandin F2 Receptor Negative Regulator (PTGFRN) ELISA Kit

Sign In for Pricing
View Details