Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2101c (Mb2101c)

This Recombinant Uncharacterized protein Mb2101c (Mb2101c) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2101c

UniProt

P64932

Expression Region

1-83

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVCLIGGVAGSLWPRPAGRLRGGCYFAFMGVAWVLLAISAIANAVKGSLWWDIWSLGLL VLIPAVVYGKMRRSRRISSDQDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethylenediamine-dimethylphosphinic acid (EDDP) Rapid Test Panel – Urine
D-DOA57P40 40 Tests

Ethylenediamine-dimethylphosphinic acid (EDDP) Rapid Test Panel – Urine

Sign In for Pricing
View Details
IFT74 polyclonal antibody
orb647866-01 50 μL

IFT74 polyclonal antibody

Sign In for Pricing
View Details
IFT74 polyclonal antibody
orb647866-02 100 µL

IFT74 polyclonal antibody

Sign In for Pricing
View Details
IFT74 polyclonal antibody
orb647866-03 200 µL

IFT74 polyclonal antibody

Sign In for Pricing
View Details
Zebrafish CYP3A65 Rabbit Polyclonal Antibody
orb3003533 100 µg

Zebrafish CYP3A65 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sheep Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform (PHKG1) ELISA Kit
MBS7225368-01 48 Well

Sheep Phosphorylase b kinase gamma catalytic chain, skeletal muscle isoform (PHKG1) ELISA Kit

Sign In for Pricing
View Details