Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2076c/MT2136 (Rv2076c, MT2136)

This Recombinant Uncharacterized protein Rv2076c/MT2136 (Rv2076c, MT2136) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2076c/MT2136

UniProt

P64931

Expression Region

1-83

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVCLIGGVAGSLWPRPAGRLRGGCYFAFMGVAWVLLAISAIANAVKGSLWWDIWSLGLL VLIPAVVYGKMRRSRRISSDQDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Formaldehyde-13C,D2 (20% in D2O)
TRC-F691353-500MG 500 mg

Formaldehyde-13C,D2 (20% in D2O)

Sign In for Pricing
View Details
GSPT1 Antibody
8C12400-AAT 50 µg

GSPT1 Antibody

Sign In for Pricing
View Details
DNAAF11 Mouse Monoclonal Antibody [Clone ID: OTI2A8]
CF805963 100 µg

DNAAF11 Mouse Monoclonal Antibody [Clone ID: OTI2A8]

Sign In for Pricing
View Details
Caldesmon (CALD1) (NM_033157) Human Recombinant Protein
TP323989L 1 mg

Caldesmon (CALD1) (NM_033157) Human Recombinant Protein

Sign In for Pricing
View Details
WDR85 (DPH7) Human Gene Knockout Kit (CRISPR)
KN205735LP 1 Kit

WDR85 (DPH7) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KEL Mouse Monoclonal Antibody [Clone ID: OTI8E1]
CF811548 100 µg

KEL Mouse Monoclonal Antibody [Clone ID: OTI8E1]

Sign In for Pricing
View Details