Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2076c/MT2136 (Rv2076c, MT2136)

This Recombinant Uncharacterized protein Rv2076c/MT2136 (Rv2076c, MT2136) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2076c/MT2136

UniProt

P64931

Expression Region

1-83

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVCLIGGVAGSLWPRPAGRLRGGCYFAFMGVAWVLLAISAIANAVKGSLWWDIWSLGLL VLIPAVVYGKMRRSRRISSDQDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF647 conjugate, 0.1mg/mL
BNC473803-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CHI3L2 (NM_001025199) Human Recombinant Protein
TP303807 20 µg

CHI3L2 (NM_001025199) Human Recombinant Protein

Sign In for Pricing
View Details
1-(4-Benzylphenyl)ethanone
TRC-B288985-2.5G 2.5 g

1-(4-Benzylphenyl)ethanone

Sign In for Pricing
View Details
SIX3 Mouse Monoclonal Antibody [Clone ID: OTI7G9]
CF811410 100 µg

SIX3 Mouse Monoclonal Antibody [Clone ID: OTI7G9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Small intestine
CS803811 5x 5 µm

Tissue FFPE Sections, Small intestine

Sign In for Pricing
View Details
Sodium Deuteroxide (40% w/w in D2O)
TRC-S624095-5G 5 g

Sodium Deuteroxide (40% w/w in D2O)

Sign In for Pricing
View Details