Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Rv2076c/MT2136 (Rv2076c, MT2136)

This Recombinant Uncharacterized protein Rv2076c/MT2136 (Rv2076c, MT2136) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein Rv2076c/MT2136

UniProt

P64931

Expression Region

1-83

Origin

Mycobacterium tuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVVCLIGGVAGSLWPRPAGRLRGGCYFAFMGVAWVLLAISAIANAVKGSLWWDIWSLGLL VLIPAVVYGKMRRSRRISSDQDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBARA1 (MICU1) Human Gene Knockout Kit (CRISPR)
KN200921BN 1 Kit

CBARA1 (MICU1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADAR1 (ADAR) (NM_001025107) Human Over-expression Lysate
LY425483 100 µg

ADAR1 (ADAR) (NM_001025107) Human Over-expression Lysate

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF647 conjugate, 0.1mg/mL
BNC472386-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2386), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DLL1 Human Gene Knockout Kit (CRISPR)
KN422399 1 Kit

DLL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF568 conjugate, 0.1mg/mL
BNC681974-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (ASTRO/1974R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (B-Cell Marker) (N/A), CF568 conjugate, 0.1mg/mL
BNC681794-500 1x 500 µL

CD45RB (B-Cell Marker) (N/A), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details