Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit c (atpE)

This Recombinant Shewanella sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A0L2T3

Expression Region

1-83

Origin

Shewanella sp. (strain ANA-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METILGMTAIAVALLIGMGALGTAIGFGLLGGKFLEGAARQPEMAPMLQVKMFIVAGLLD AVTMIGVGIALFMLFTNPLGAML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta Glucuronidase Antibody
KC-3954-01 50 μL

Beta Glucuronidase Antibody

Sign In for Pricing
View Details
Beta Glucuronidase Antibody
KC-3954-02 100 µL

Beta Glucuronidase Antibody

Sign In for Pricing
View Details
Beta Glucuronidase Antibody
KC-3954-03 1 mL

Beta Glucuronidase Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD27 Antibody[O323]
E-AB-F1140I-01 20 Tests

PE/Cyanine5.5 Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD27 Antibody[O323]
E-AB-F1140I-02 100 Tests

PE/Cyanine5.5 Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Human CD27 Antibody[O323]
E-AB-F1140I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Human CD27 Antibody[O323]

Sign In for Pricing
View Details