Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit c (atpE)

This Recombinant Shewanella sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A0L2T3

Expression Region

1-83

Origin

Shewanella sp. (strain ANA-3)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METILGMTAIAVALLIGMGALGTAIGFGLLGGKFLEGAARQPEMAPMLQVKMFIVAGLLD AVTMIGVGIALFMLFTNPLGAML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACC2 Mouse Monoclonal Antibody [Clone ID: OTI2G3]
CF804148 100 µg

TACC2 Mouse Monoclonal Antibody [Clone ID: OTI2G3]

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S-stable trimer Protein (C-6His)
PKSV030314-01 50 µg

Recombinant SARS-CoV-2 S-stable trimer Protein (C-6His)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S-stable trimer Protein (C-6His)
PKSV030314-02 500 µg

Recombinant SARS-CoV-2 S-stable trimer Protein (C-6His)

Sign In for Pricing
View Details
Tissue FFPE Sections, Vagina
CS702704 5x 5 µm

Tissue FFPE Sections, Vagina

Sign In for Pricing
View Details
Mouse Cdhr5 activation kit by CRISPRa
GA209070 1 Kit

Mouse Cdhr5 activation kit by CRISPRa

Sign In for Pricing
View Details
QuantiFluo™ Adenosine Deaminase Assay Kit
DADA-100 100 Tests

QuantiFluo™ Adenosine Deaminase Assay Kit

Sign In for Pricing
View Details