Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorghum bicolor Cytochrome b559 subunit alpha (psbE)

This Recombinant Sorghum bicolor Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A1E9U1

Expression Region

1-83

Origin

Sorghum bicolor (Sorghum) (Sorghum vulgare)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITDRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau (S305) Antibody
KC-43076-01 50 μL

Tau (S305) Antibody

Sign In for Pricing
View Details
Tau (S305) Antibody
KC-43076-02 100 µL

Tau (S305) Antibody

Sign In for Pricing
View Details
Tau (S305) Antibody
KC-43076-03 1 mL

Tau (S305) Antibody

Sign In for Pricing
View Details
Thy1 Rat Monoclonal Antibody [Clone ID: G7]
AM08054FC-N 500 µg

Thy1 Rat Monoclonal Antibody [Clone ID: G7]

Sign In for Pricing
View Details
D-erythro-Ethylphenidate Hydrochloride
TRC-E925625-5MG 5 mg

D-erythro-Ethylphenidate Hydrochloride

Sign In for Pricing
View Details
Human BAGE5 activation kit by CRISPRa
GA113849 1 Kit

Human BAGE5 activation kit by CRISPRa

Sign In for Pricing
View Details