Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sorghum bicolor Cytochrome b559 subunit alpha (psbE)

This Recombinant Sorghum bicolor Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A1E9U1

Expression Region

1-83

Origin

Sorghum bicolor (Sorghum) (Sorghum vulgare)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITDRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL5A Rabbit Polyclonal Antibody
TA371859 100 µL

ARL5A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560589 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
Prpsap1 Mouse Gene Knockout Kit (CRISPR)
KN513985 1 Kit

Prpsap1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Carbonzoxy-valyl-glycyl-arginine-4-nitril-anilide acetate
TRC-C861760-25MG 25 mg

Carbonzoxy-valyl-glycyl-arginine-4-nitril-anilide acetate

Sign In for Pricing
View Details
FITC Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-
F-2201-2 2 mg

FITC Conjugated Ulex europaeus Lectin (GorseFurze) -UEA-I-

Sign In for Pricing
View Details
Human STAMBPL1 activation kit by CRISPRa
GA111588 1 Kit

Human STAMBPL1 activation kit by CRISPRa

Sign In for Pricing
View Details