Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrostis stolonifera Cytochrome b559 subunit alpha (psbE)

This Recombinant Agrostis stolonifera Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A1EA25

Expression Region

1-83

Origin

Agrostis stolonifera (Creeping bentgrass)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITDRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Forget-Me-NotTM EvaGreen® qPCR Master Mix with ROX (100 reactions)
#31042-T 1x 1 mL

Forget-Me-NotTM EvaGreen® qPCR Master Mix with ROX (100 reactions)

Sign In for Pricing
View Details
Human Endorepellin/Perlecan, C-His Tag
HA211127-01 20 µg

Human Endorepellin/Perlecan, C-His Tag

Sign In for Pricing
View Details
Human Endorepellin/Perlecan, C-His Tag
HA211127-02 50 µg

Human Endorepellin/Perlecan, C-His Tag

Sign In for Pricing
View Details
Human Endorepellin/Perlecan, C-His Tag
HA211127-03 100 µg

Human Endorepellin/Perlecan, C-His Tag

Sign In for Pricing
View Details
FAM84B Polyclonal Antibody
E-AB-19849-01 20 µL

FAM84B Polyclonal Antibody

Sign In for Pricing
View Details
FAM84B Polyclonal Antibody
E-AB-19849-02 60 µL

FAM84B Polyclonal Antibody

Sign In for Pricing
View Details