Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrostis stolonifera Cytochrome b559 subunit alpha (psbE)

This Recombinant Agrostis stolonifera Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A1EA25

Expression Region

1-83

Origin

Agrostis stolonifera (Creeping bentgrass)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITDRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α, ω-Bis-Bromo PEG
116000-1.1G 1 g

α, ω-Bis-Bromo PEG

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS808182 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Mouse Ercc3 activation kit by CRISPRa
GA201287 1 Kit

Mouse Ercc3 activation kit by CRISPRa

Sign In for Pricing
View Details
Pyrimitate
TRC-P997785-50MG 50 mg

Pyrimitate

Sign In for Pricing
View Details
Mouse Cited1 activation kit by CRISPRa
GA200738 1 Kit

Mouse Cited1 activation kit by CRISPRa

Sign In for Pricing
View Details
STAU1 Antibody
KC-2034-01 50 μL

STAU1 Antibody

Sign In for Pricing
View Details