Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Agrostis stolonifera Cytochrome b559 subunit alpha (psbE)

This Recombinant Agrostis stolonifera Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A1EA25

Expression Region

1-83

Origin

Agrostis stolonifera (Creeping bentgrass)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITDRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEPTIN7 Human Gene Knockout Kit (CRISPR)
KN205163BN 1 Kit

SEPTIN7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Protein Lysate, Ovary: left
CP565738 150 µg

Tissue Protein Lysate, Ovary: left

Sign In for Pricing
View Details
CD79a (B-Cell Marker) (ZL7-4), CF568 conjugate, 0.1mg/mL
BNC681627-500 1x 500 µL

CD79a (B-Cell Marker) (ZL7-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CAB39 (NM_016289) Human Recombinant Protein
TP304563 20 µg

CAB39 (NM_016289) Human Recombinant Protein

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]
E-AB-F1254I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]
E-AB-F1254I-02 100 Tests

PE/Cyanine5.5 Anti-Mouse CD107a/LAMP-1 Antibody[1D4B]

Sign In for Pricing
View Details