Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis ATP synthase subunit c (atpE)

This Recombinant Shewanella amazonensis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1SBU5

Expression Region

1-83

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METILGFTAIAVALLIGMGALGTAIGFGLLGGKFLEGAARQPEMAPMLQVKMFIVAGLLD AVTMIGVGIALYMLFTNPLGAML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Apolipoprotein B (APOB)
RPU57052-01 50 µg

Recombinant Apolipoprotein B (APOB)

Sign In for Pricing
View Details
Recombinant Apolipoprotein B (APOB)
RPU57052-02 100 µg

Recombinant Apolipoprotein B (APOB)

Sign In for Pricing
View Details
Recombinant Apolipoprotein B (APOB)
RPU57052-03 1 mg

Recombinant Apolipoprotein B (APOB)

Sign In for Pricing
View Details
Rabbit Polyclonal GRK4 Antibody
NBP2-37960-25ul 25 µL

Rabbit Polyclonal GRK4 Antibody

Sign In for Pricing
View Details
GNA14 Polyclonal Antibody, HRP Conjugated
A62663-100 100 µL

GNA14 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Alectinib Impurity 2
RM-A329002-01 10 mg

Alectinib Impurity 2

Sign In for Pricing
View Details