Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella amazonensis ATP synthase subunit c (atpE)

This Recombinant Shewanella amazonensis ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

A1SBU5

Expression Region

1-83

Origin

Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METILGFTAIAVALLIGMGALGTAIGFGLLGGKFLEGAARQPEMAPMLQVKMFIVAGLLD AVTMIGVGIALYMLFTNPLGAML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NADE (BEX3) (NM_014380) Human Over-expression Lysate
E45H09144-2 20 µg

NADE (BEX3) (NM_014380) Human Over-expression Lysate

Sign In for Pricing
View Details
Aurora A Rabbit Polyclonal Antibody (Biotin)
orb447476 100 µL

Aurora A Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
ACK1 Antibody
orb844043 2 mg

ACK1 Antibody

Sign In for Pricing
View Details
Glucagon-Like Peptide 2 (GLP-2) discontinued
214856 1 mg

Glucagon-Like Peptide 2 (GLP-2) discontinued

Sign In for Pricing
View Details
TDS Calibration Solution ppm 1382 ± 0.002% mg/l @25°c Traceable To NIST
T0011 00500 500 mL

TDS Calibration Solution ppm 1382 ± 0.002% mg/l @25°c Traceable To NIST

Sign In for Pricing
View Details
N, N'-Di (1-naphthyl) -N, N',9,9-tetraphenyl-9H-fluorene-2,7-diamine
OR76044-01 250 mg

N, N'-Di (1-naphthyl) -N, N',9,9-tetraphenyl-9H-fluorene-2,7-diamine

Sign In for Pricing
View Details