Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A5GQF4

Expression Region

1-83

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIITSIRYWVIHAVTLPAIFLAGFLFVSTGLAYDAFGTPRPDSYFQAA DVKAPVVSQRYEGKSQLDTRLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Flurobenzenesulfinic acid sodium salt
TRC-F600610-500MG 500 mg

4-Flurobenzenesulfinic acid sodium salt

Sign In for Pricing
View Details
Pigment Red 146 (Technical Grade)
TRC-P227965-5G 5 g

Pigment Red 146 (Technical Grade)

Sign In for Pricing
View Details
Tafa5 (NM_134096) Mouse Tagged ORF Clone
MG200644 10 µg

Tafa5 (NM_134096) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Calbryte™-520XL AM
20646-AAT 10x 50 µg

Calbryte™-520XL AM

Sign In for Pricing
View Details
Cathepsin G (CTSG) Rabbit Polyclonal Antibody
TA375217 100 µL

Cathepsin G (CTSG) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Avasimibe
TRC-A794680-25MG 25 mg

Avasimibe

Sign In for Pricing
View Details