Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A5GQF4

Expression Region

1-83

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIITSIRYWVIHAVTLPAIFLAGFLFVSTGLAYDAFGTPRPDSYFQAA DVKAPVVSQRYEGKSQLDTRLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KATNAL1 (NM_001014380) Human Over-expression Lysate
LC423055 20 µg

KATNAL1 (NM_001014380) Human Over-expression Lysate

Sign In for Pricing
View Details
FluoroQuest™ Fluorescence Signal Enhancing Solution
20006-AAT 5 mL

FluoroQuest™ Fluorescence Signal Enhancing Solution

Sign In for Pricing
View Details
CF®770DI Hydrazide
#92185 1x 1 mg

CF®770DI Hydrazide

Sign In for Pricing
View Details
DL-Glyceraldehyde-1,3-13C2 (~ 0.1M Solution) (>85%)
TRC-G598220-25MG 25 mg

DL-Glyceraldehyde-1,3-13C2 (~ 0.1M Solution) (>85%)

Sign In for Pricing
View Details
NDUFB6 (NM_002493) Human Over-expression Lysate
LC419293 20 µg

NDUFB6 (NM_002493) Human Over-expression Lysate

Sign In for Pricing
View Details
HNRNPA0 (NM_006805) Human Recombinant Protein
TP303666M 100 µg

HNRNPA0 (NM_006805) Human Recombinant Protein

Sign In for Pricing
View Details