Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE)

This Recombinant Synechococcus sp. Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A5GQF4

Expression Region

1-83

Origin

Synechococcus sp. (strain RCC307)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAGSTGERPFFEIITSIRYWVIHAVTLPAIFLAGFLFVSTGLAYDAFGTPRPDSYFQAA DVKAPVVSQRYEGKSQLDTRLKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 7 (KRT7/903), CF640R conjugate, 0.1mg/mL
BNC400903-100 1x 100 µL

Cytokeratin 7 (KRT7/903), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2644), CF405S conjugate, 0.1mg/mL
BNC042644-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2644), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2,4-Lutidine
TRC-L478025-10G 10 g

2,4-Lutidine

Sign In for Pricing
View Details
Cy3B maleimide
942-AAT 1 mg

Cy3B maleimide

Sign In for Pricing
View Details
RAVER2 Human Knockdown Lysate
LY300418 100 µg

RAVER2 Human Knockdown Lysate

Sign In for Pricing
View Details
Lidamidine Hydrochloride
TRC-L397790-10MG 10 mg

Lidamidine Hydrochloride

Sign In for Pricing
View Details