Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Cytochrome b559 subunit alpha (psbE)

This Recombinant Cuscuta reflexa Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A7M969

Expression Region

1-83

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDSLEQLNEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-p-Iodo-D-Phe-OH
F-1670.0250 250.0mg

H-p-Iodo-D-Phe-OH

Sign In for Pricing
View Details
Recombinant Staphylococcus Aureus SACOL2196 Protein (aa 1-271)
VAng-Cr6222-500gEcoli 500 µg (E. coli)

Recombinant Staphylococcus Aureus SACOL2196 Protein (aa 1-271)

Sign In for Pricing
View Details
MicroLoop LD Assembly; box of 20 assemblies
B-M5-200LD-B3-R 20 Mounts/Base Assemblies

MicroLoop LD Assembly; box of 20 assemblies

Sign In for Pricing
View Details
Lentiviral human SLC10A4 shRNA (UAS) - Lentiviral human SLC10A4 shRNA (UAS) (25)
GTR15295616 1 Vial

Lentiviral human SLC10A4 shRNA (UAS) - Lentiviral human SLC10A4 shRNA (UAS) (25)

Sign In for Pricing
View Details
Spark Blue™ 515 anti-human CD11c
GT11369 25 Tests

Spark Blue™ 515 anti-human CD11c

Sign In for Pricing
View Details
Rabbit Polyclonal IFITM1 Antibody [DyLight 405]
NBP1-77171V 0.1 mL

Rabbit Polyclonal IFITM1 Antibody [DyLight 405]

Sign In for Pricing
View Details