Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Cytochrome b559 subunit alpha (psbE)

This Recombinant Cuscuta reflexa Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A7M969

Expression Region

1-83

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDSLEQLNEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ANKRA2 (NM_023039) AAV Particle
RC204384A1V 250 µL

Human ANKRA2 (NM_023039) AAV Particle

Sign In for Pricing
View Details
Trisphenyl(3,3,3-trifluoroprop-1-yl)phosphonium Iodide
TRC-T896295-500MG 500 mg

Trisphenyl(3,3,3-trifluoroprop-1-yl)phosphonium Iodide

Sign In for Pricing
View Details
Vimentin Monoclonal Antibody AE00237
AE00237 0.1mg

Vimentin Monoclonal Antibody AE00237

Sign In for Pricing
View Details
Claudin 19 Rabbit Polyclonal Antibody (BF680)
orb2521737 100 µL

Claudin 19 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Oct-4B/OCT4B-190 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-3816R-PE-Cy5.5 100 µL

Oct-4B/OCT4B-190 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
2-Butyl-4-chloro-1H-imidazole-5-carboxaldehyde
TRC-B690630-25G 25 g

2-Butyl-4-chloro-1H-imidazole-5-carboxaldehyde

Sign In for Pricing
View Details