Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Cytochrome b559 subunit alpha (psbE)

This Recombinant Cuscuta reflexa Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

A7M969

Expression Region

1-83

Origin

Cuscuta reflexa (Southern Asian dodder)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGNTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDSLEQLNEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JWA (h) -PR
sc-60874-PR 10 µM - 20 µL

JWA (h) -PR

Sign In for Pricing
View Details
CLRN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0468608 1.0 µg DNA

CLRN2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TAS1R3 siRNA (Mouse)
CRN0189-01 15 nmol

TAS1R3 siRNA (Mouse)

Sign In for Pricing
View Details
TAS1R3 siRNA (Mouse)
CRN0189-02 30 nmol

TAS1R3 siRNA (Mouse)

Sign In for Pricing
View Details
10-DAB (10-Deacetylbaccatin)
A4395-200 200 mg

10-DAB (10-Deacetylbaccatin)

Sign In for Pricing
View Details
Chaperonin Containing TCP1, Subunit 6A (CCT6A) Antibody
abx111566 100 µL

Chaperonin Containing TCP1, Subunit 6A (CCT6A) Antibody

Sign In for Pricing
View Details