Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized membrane protein yoyJ (yoyJ)

This Recombinant Uncharacterized membrane protein yoyJ (yoyJ) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yoyJ

UniProt

C0H439

Expression Region

1-83

Origin

Bacillus subtilis

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFSFSSYPYYNMIKHIANMKRFSLWFTHITFIGLFLMFQLIKDYFSSEGQALINTIFVV TCIIAILLWIIYCVFLKLRNKSH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LSM2 Blocking Peptide
33R-9016 0.1 mg

LSM2 Blocking Peptide

Sign In for Pricing
View Details
RPS26 siRNA (Rat)
MBS8222443-01 15 nmol

RPS26 siRNA (Rat)

Sign In for Pricing
View Details
RPS26 siRNA (Rat)
MBS8222443-02 30 nmol

RPS26 siRNA (Rat)

Sign In for Pricing
View Details
RPS26 siRNA (Rat)
MBS8222443-03 5x 30 nmol

RPS26 siRNA (Rat)

Sign In for Pricing
View Details
Epsilon-momfluorothrin
BA9211-5.1 1 mL (10 mM in DMSO)

Epsilon-momfluorothrin

Sign In for Pricing
View Details
Creatine kinase-B shRNA Plasmid (m)
sc-35108-SH 20 µg

Creatine kinase-B shRNA Plasmid (m)

Sign In for Pricing
View Details