Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit c (atpE)

This Recombinant Shewanella sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0HD74

Expression Region

1-83

Origin

Shewanella sp. (strain MR-4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METILGMTAIAVALLIGMGALGTAIGFGLLGGKFLEGAARQPEMAPMLQVKMFIVAGLLD AVTMIGVGIALFMLFTNPLGAML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 Mouse Monoclonal Antibody [Clone ID: CT-8]
AM08116RP-N 100 µg

CD8 Mouse Monoclonal Antibody [Clone ID: CT-8]

Sign In for Pricing
View Details
Frozen Tissue Sections, Liver
CS520122 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
CPN1 Rabbit Polyclonal Antibody
AP01465PU-N 100 µg

CPN1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZSWIM5 activation kit by CRISPRa
GA111653 1 Kit

Human ZSWIM5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS700514 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
ATL3 Recombinant Rabbit Monoclonal Antibody [PSH02-47]
HA721824 100 µL

ATL3 Recombinant Rabbit Monoclonal Antibody [PSH02-47]

Sign In for Pricing
View Details