Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. ATP synthase subunit c (atpE)

This Recombinant Shewanella sp. ATP synthase subunit c (atpE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

ATP synthase subunit c, ATP synthase F (0) sector subunit c, F-type ATPase subunit c, F-ATPase subunit c, Lipid-binding protein

UniProt

Q0HD74

Expression Region

1-83

Origin

Shewanella sp. (strain MR-4)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METILGMTAIAVALLIGMGALGTAIGFGLLGGKFLEGAARQPEMAPMLQVKMFIVAGLLD AVTMIGVGIALFMLFTNPLGAML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF488A conjugate, 0.1mg/mL
BNC882755-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (ADFP/2755R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS702695 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Aurora A (AURKA) Rabbit Polyclonal Antibody
AP20206PU-N 100 µg

Aurora A (AURKA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CHUK Rabbit Monoclonal Antibody [Clone ID: 23GB765]
TA424882 100 µL

CHUK Rabbit Monoclonal Antibody [Clone ID: 23GB765]

Sign In for Pricing
View Details
3,3'-Dithio(succinimidyl propionate)
TRC-D494275-50MG 50 mg

3,3'-Dithio(succinimidyl propionate)

Sign In for Pricing
View Details
TentaGel® MAP 8 branch
J2004.1G 1 g

TentaGel® MAP 8 branch

Sign In for Pricing
View Details