Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus alba Cytochrome b559 subunit alpha (psbE)

This Recombinant Populus alba Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q14FE0

Expression Region

1-83

Origin

Populus alba (White poplar)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PISD Mouse Monoclonal Antibody [Clone ID: OTI6C3]
CF807333 100 µg

PISD Mouse Monoclonal Antibody [Clone ID: OTI6C3]

Sign In for Pricing
View Details
LGALS1 Rabbit Monoclonal Antibody [Clone ID: 23GB6025]
TA424796 100 µL

LGALS1 Rabbit Monoclonal Antibody [Clone ID: 23GB6025]

Sign In for Pricing
View Details
C11orf97 Human Gene Knockout Kit (CRISPR)
KN430962 1 Kit

C11orf97 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Syna Mouse Gene Knockout Kit (CRISPR)
KN517050 1 Kit

Syna Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human HNRPA3 (HNRNPA3) activation kit by CRISPRa
GA116582 1 Kit

Human HNRPA3 (HNRNPA3) activation kit by CRISPRa

Sign In for Pricing
View Details
TCP11 (NM_001093728) Human Recombinant Protein
TP321388M 100 µg

TCP11 (NM_001093728) Human Recombinant Protein

Sign In for Pricing
View Details