Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus alba Cytochrome b559 subunit alpha (psbE)

This Recombinant Populus alba Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q14FE0

Expression Region

1-83

Origin

Populus alba (White poplar)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]
E-AB-F1143J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]
E-AB-F1143J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]
E-AB-F1143J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD34 Antibody[581]

Sign In for Pricing
View Details
5-Chloro-4-nitro-2,1,3-benzoselenadiazole
TRC-C373890-2G 2 g

5-Chloro-4-nitro-2,1,3-benzoselenadiazole

Sign In for Pricing
View Details
Monoacylglycerol Lipase (MGLL) (NM_007283) Human Over-expression Lysate
LY402124 100 µg

Monoacylglycerol Lipase (MGLL) (NM_007283) Human Over-expression Lysate

Sign In for Pricing
View Details
Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF488A conjugate, 0.1mg/mL
BNC882053-100 1x 100 µL

Nucleophosmin (Acute Myeloid Leukemia Marker) (NA24), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details