Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus alba Cytochrome b559 subunit alpha (psbE)

This Recombinant Populus alba Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q14FE0

Expression Region

1-83

Origin

Populus alba (White poplar)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse EGFR Protein (His Tag)
PKSM040365 100 µg

Recombinant Mouse EGFR Protein (His Tag)

Sign In for Pricing
View Details
Mouse Nuclear Factor I/B (NFIB) ELISA Kit
RD-NFIB-Mu-01 96 Tests

Mouse Nuclear Factor I/B (NFIB) ELISA Kit

Sign In for Pricing
View Details
Mouse Nuclear Factor I/B (NFIB) ELISA Kit
RD-NFIB-Mu-02 48 Tests

Mouse Nuclear Factor I/B (NFIB) ELISA Kit

Sign In for Pricing
View Details
2-Ethylhexyl Salicylate-d4
TRC-E918777-1MG 1 mg

2-Ethylhexyl Salicylate-d4

Sign In for Pricing
View Details
PPP3CC (C-term) Rabbit Polyclonal Antibody
AP15297PU-N 400 µL

PPP3CC (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
URB1 Antibody
8C17153-AAT 50 µg

URB1 Antibody

Sign In for Pricing
View Details