Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Solanum bulbocastanum Cytochrome b559 subunit alpha (psbE)

This Recombinant Solanum bulbocastanum Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q2MIH0

Expression Region

1-83

Origin

Solanum bulbocastanum (Wild potato)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL
BNC400345-500 1x 500 µL

CD4 (EDU-2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL
BNC740204-500 1x 500 µL

Complement C4d (C4D204), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-100 1x 100 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF640R conjugate, 0.1mg/mL
BNC400418-500 1x 500 µL

Fascin-1 (FSCN1/418), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdc20 (AR12), CF568 conjugate, 0.1mg/mL
BNC680672-500 1x 500 µL

Cdc20 (AR12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (H+L) (NF421 + NFL736), CF405S conjugate, 0.1mg/mL
BNC040756-100 1x 100 µL

Neurofilament (H+L) (NF421 + NFL736), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details