Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Cytochrome b559 subunit alpha (psbE)

This Recombinant Glycine max Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q2PMR7

Expression Region

1-83

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESR QGIPLITGRFDPLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benchtop Low Speed Centrifuge BCBL-208
BCBL-208 1 Unit

Benchtop Low Speed Centrifuge BCBL-208

Sign In for Pricing
View Details
TRIM45 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B11]
TA505917AM 100 µL

TRIM45 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B11]

Sign In for Pricing
View Details
FBXO43 Human Gene Knockout Kit (CRISPR)
KN416347 1 Kit

FBXO43 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LRRC75A Antibody (Biotin)
KB-3718-01 50 μL

LRRC75A Antibody (Biotin)

Sign In for Pricing
View Details
LRRC75A Antibody (Biotin)
KB-3718-02 100 µL

LRRC75A Antibody (Biotin)

Sign In for Pricing
View Details
LRRC75A Antibody (Biotin)
KB-3718-03 1 mL

LRRC75A Antibody (Biotin)

Sign In for Pricing
View Details