Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas phage Pf1 Uncharacterized protein ORF83

This Recombinant Pseudomonas phage Pf1 Uncharacterized protein ORF83 spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Uncharacterized protein ORF83, ORF083

UniProt

Q38065

Expression Region

1-83

Origin

Pseudomonas phage Pf1 (Bacteriophage Pf1)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGVVAVQVCTAWTSTPEGFMACRELAWQQAYLIPPEAAGYVDILVNGGFSPEAFGIGAA GVLGSFVTGLLIGWVASLLRKAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAI2 Antibody
8G214-AAT 50 µg

BAI2 Antibody

Sign In for Pricing
View Details
KCNH1 (NM_002238) Human Over-expression Lysate
LC419457 20 µg

KCNH1 (NM_002238) Human Over-expression Lysate

Sign In for Pricing
View Details
Bis(2-chloroethyl)amine-d4 Hydrochloride
TRC-B418802-1MG 1 mg

Bis(2-chloroethyl)amine-d4 Hydrochloride

Sign In for Pricing
View Details
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF405S conjugate, 0.1mg/mL
BNC042130-500 1x 500 µL

Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTRR (NM_024010) Human Over-expression Lysate
LC402971 20 µg

MTRR (NM_024010) Human Over-expression Lysate

Sign In for Pricing
View Details
Apolipoprotein A I (APOA1) (NM_000039) Human Over-expression Lysate
LC400009 20 µg

Apolipoprotein A I (APOA1) (NM_000039) Human Over-expression Lysate

Sign In for Pricing
View Details