Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa Cytochrome b559 subunit alpha (psbE)

This Recombinant Lactuca sativa Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q332W1

Expression Region

1-83

Origin

Lactuca sativa (Garden lettuce)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENR QGIPLITGRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT5C3 (NT5C3A) (NM_001002009) Human Recombinant Protein
TP309741 20 µg

NT5C3 (NT5C3A) (NM_001002009) Human Recombinant Protein

Sign In for Pricing
View Details
GPR171 Polyclonal Antibody
E-AB-16469-01 20 µL

GPR171 Polyclonal Antibody

Sign In for Pricing
View Details
GPR171 Polyclonal Antibody
E-AB-16469-02 60 µL

GPR171 Polyclonal Antibody

Sign In for Pricing
View Details
GPR171 Polyclonal Antibody
E-AB-16469-03 120 µL

GPR171 Polyclonal Antibody

Sign In for Pricing
View Details
GPR171 Polyclonal Antibody
E-AB-16469-04 200 µL

GPR171 Polyclonal Antibody

Sign In for Pricing
View Details
Ptpn14 Mouse Gene Knockout Kit (CRISPR)
KN514210 1 Kit

Ptpn14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details