Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa Cytochrome b559 subunit alpha (psbE)

This Recombinant Lactuca sativa Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q332W1

Expression Region

1-83

Origin

Lactuca sativa (Garden lettuce)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENR QGIPLITGRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF468 activation kit by CRISPRa
GA114005 1 Kit

Human ZNF468 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057L-01 20 Tests

Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057L-02 100 Tests

Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]
E-AB-F1057L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD18 Antibody[TS1/18.1.2.11]

Sign In for Pricing
View Details
2,3,3',4,4',5'-Hexachlorobiphenyl
TRC-H295033-5MG 5 mg

2,3,3',4,4',5'-Hexachlorobiphenyl

Sign In for Pricing
View Details
Zyxin (ZYX) Human Gene Knockout Kit (CRISPR)
KN400960 1 Kit

Zyxin (ZYX) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details