Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactuca sativa Cytochrome b559 subunit alpha (psbE)

This Recombinant Lactuca sativa Cytochrome b559 subunit alpha (psbE) spans the amino acid sequence from region 1-83.

Product Specifications

Product Name Alternative

Cytochrome b559 subunit alpha, PSII reaction center subunit V

UniProt

Q332W1

Expression Region

1-83

Origin

Lactuca sativa (Garden lettuce)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTENR QGIPLITGRFDSLEQLDEFSRSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

9-(2-Chloro-ethyl)-9H-purin-6-ylamine
TRC-C366190-500MG 500 mg

9-(2-Chloro-ethyl)-9H-purin-6-ylamine

Sign In for Pricing
View Details
mIgG2a and mIgG2b Fcγ Fragment Specific Rabbit monoclonal antibody,clone OTIR9H1
TA592580S 30 µL

mIgG2a and mIgG2b Fcγ Fragment Specific Rabbit monoclonal antibody,clone OTIR9H1

Sign In for Pricing
View Details
Cirhin (UTP4) (NM_032830) Human Recombinant Protein
TP303667L 1 mg

Cirhin (UTP4) (NM_032830) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Thyroid gland
CS712857 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
RED1 (ADARB1) (NM_001112) Human Recombinant Protein
TP309073M 100 µg

RED1 (ADARB1) (NM_001112) Human Recombinant Protein

Sign In for Pricing
View Details
Human CD80 Recombinant Rabbit monoclonal Antibody
HA723124 100 µL

Human CD80 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details